PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.005G020200.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 384aa    MW: 40616.6 Da    PI: 7.4358
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.005G020200.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.89.4e-173885148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          +g+WT+eEd +lv +++++G+g+W++++   g+ R+ k+c++rw +yl
  Sobic.005G020200.2.p 38 KGPWTPEEDIILVSYIQEHGPGNWRSVPINTGLMRCSKSCRLRWTNYL 85
                          79********************************************97 PP

2Myb_DNA-binding47.15.5e-1591136148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                           rg++T+ E+ ++v++  +lG++ W++Ia++++  Rt++++k++w+++l
  Sobic.005G020200.2.p  91 RGNFTPHEEGIIVHLQSLLGNR-WAAIASYLP-QRTDNDIKNYWNTHL 136
                           89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.6E-232988IPR009057Homeodomain-like
PROSITE profilePS5129425.5173389IPR017930Myb domain
SuperFamilySSF466896.68E-3035132IPR009057Homeodomain-like
SMARTSM007174.4E-133787IPR001005SANT/Myb domain
PfamPF002491.5E-153885IPR001005SANT/Myb domain
CDDcd001671.54E-114085No hitNo description
Gene3DG3DSA:1.10.10.609.0E-2489141IPR009057Homeodomain-like
SMARTSM007175.4E-1390138IPR001005SANT/Myb domain
PROSITE profilePS5129418.7490140IPR017930Myb domain
PfamPF002497.4E-1391136IPR001005SANT/Myb domain
CDDcd001678.51E-993134No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 384 aa     Download sequence    Send to blast
MGADLLATIN IATGRGREGA AGAAMGRPPC CDKEGIKKGP WTPEEDIILV SYIQEHGPGN  60
WRSVPINTGL MRCSKSCRLR WTNYLRPGIR RGNFTPHEEG IIVHLQSLLG NRWAAIASYL  120
PQRTDNDIKN YWNTHLKKKL KKHQAIGAIF APPPPPASDS SSSSSIVVMP TTTVGGGGGG  180
CHVHHHHRDM LGGGTNLLVS RDSYYARPSG GAGCCSNPAE VAQLIARRSP FAADGGGDSS  240
SSSYASSMDN ISKLLTGFMK QQQSSPSPDA AAAADIKPSS AAHVNNHHAL LSSSSSFHHM  300
SAAGTGSGTP PAAACFNDMT MPSPPHVQQQ AALMGHHGGY DDDPRQASPL SPIEKWLFEE  360
AAEQVGDLMD LSEDCCSSVP MMF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A4e-26381404105MYB PROTO-ONCOGENE PROTEIN
1mse_C4e-26381404105C-Myb DNA-Binding Domain
1msf_C4e-26381404105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7283081e-154KJ728308.1 Zea mays clone pUT6588 MYB transcription factor (MYB69) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002450190.11e-175hypothetical protein SORBIDRAFT_05g001730
TrEMBLC5Y3P21e-175C5Y3P2_SORBI; Putative uncharacterized protein Sb05g001730
STRINGSb05g001730.11e-174(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22938296
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08810.16e-78myb domain protein 60